PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015892860.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family ARR-B
Protein Properties Length: 658aa    MW: 73210.4 Da    PI: 8.5106
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015892860.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like75.85.9e-24205257255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     p ++W+ eLH++Fv av+qL G e A+P +i  lm+vkgLt e+v+SHLQ+YR+
  XP_015892860.1 205 PCVVWSVELHRKFVAAVNQL-GLETAVPMKIIALMNVKGLTSENVASHLQQYRS 257
                     6789****************.9*******************************7 PP

2Response_reg78.13e-26261341109
                     EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTT CS
    Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaG 93 
                     vl vdD+pl +++l+++l+k +y +v+++ ++ +al++l+ ++  +D++++ ++mp+mdG+++l+  r e  +lp+i+++a+++ +++ + + +G
  XP_015892860.1  26 VLAVDDDPLRLKVLETMLRKCQY-QVTATNKAIKALKMLRVNRnrYDIVITEVNMPEMDGFKFLELVRLEM-DLPVIMLSANSDTKLVMKGITLG 118
                     799********************.***************888888*******************9988865.*********************** PP

                     ESEEEESS--HHHHHH CS
    Response_reg  94 akdflsKpfdpeelvk 109
                     a d+l Kp+ +e+l +
  XP_015892860.1 119 ACDYLLKPVRIERLKN 134
                     *************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363928.3E-1381636IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23001.7E-3923157No hitNo description
SuperFamilySSF521723.7E-3423146IPR011006CheY-like superfamily
SMARTSM004484.3E-3024136IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.89525140IPR001789Signal transduction response regulator, receiver domain
PfamPF000728.5E-2426134IPR001789Signal transduction response regulator, receiver domain
CDDcd001565.33E-2727140No hitNo description
SuperFamilySSF466891.68E-15202261IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.3E-25202262IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-19204257IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 658 aa     Download sequence    Send to blast
MTVEGQRYSF MFEDGATDRF PVGMRVLAVD DDPLRLKVLE TMLRKCQYQV TATNKAIKAL  60
KMLRVNRNRY DIVITEVNMP EMDGFKFLEL VRLEMDLPVI MLSANSDTKL VMKGITLGAC  120
DYLLKPVRIE RLKNIWQHVI RKRMCDSKDQ NKSPDLDKAC HGTESANSVA ISGNSGENDK  180
LSMKQKHRNE EEKEYGKDDE TEKKPCVVWS VELHRKFVAA VNQLGLETAV PMKIIALMNV  240
KGLTSENVAS HLQQYRSYLK RLNNMQAQYC GKAAPLGVKD STYLQMGSID GSLSVANTAL  300
SSYSPGGMLG RLNSPVGLNL PGITPSGLAE PVDPQNLSNS SNSLGKLQGS VLASQFKNLF  360
IQIPTSLEHN ELQQDKCTAH IGGFNSINNT TGNPLMFQWN PQPTHSILAL MNLGLASSNP  420
KSIELGNRVL SNFPDHNRCS ESLQGAGQLS KFPSNAVSMS GSYNHDHSHS SNLGISSTCH  480
QIGNNPQGFS SVSVPFSLLA EPRGDVQCRE GLIGNIVQPI NYIRKQRWEE HEQDYRHYMN  540
WTFGAINSSV SADRNLNPLS QNLDKSDAVC SKNKDQSNGI TPSALHSIVV EKSAMETKMK  600
PSFDQTKLQG GQMKNRYGSL DDIMSSITKR VWRFLALALL IYVLLLWQSH NCEWISYS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-18202263364ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015892860.10.0PREDICTED: two-component response regulator ORR24-like isoform X3
TrEMBLM5WH030.0M5WH03_PRUPE; Uncharacterized protein
STRINGVIT_11s0206g00060.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.15e-96response regulator 12